Recombinant Full Length Arabidopsis Thaliana Caax Prenyl Protease 1 Homolog(Face1) Protein, His-Tagged
Cat.No. : | RFL11258AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CAAX prenyl protease 1 homolog(FACE1) Protein (Q8RX88) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS YFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ ITDLPFSLYSTFVIESRHGFNKQTIWMFIRDMIKGTFLSVILGPPIVAAIIFIVQKGGPY LAIYLWAFMFILSLVMMTIYPVLIAPLFNKFTPLPDGDLREKIEKLASSLKFPLKKLFVV DGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIA VQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRA FEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGED KKTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FACE1 |
Synonyms | FACE1; STE24; At4g01320; A_IG002N01.21; F2N1.21; CAAX prenyl protease 1 homolog; Farnesylated proteins-converting enzyme 1; AtFACE-1; FACE-1; Prenyl protein-specific endoprotease 1; Zinc metalloproteinase Ste24 homolog; AtSTE24 |
UniProt ID | Q8RX88 |
◆ Recombinant Proteins | ||
Map2k1-1350MF | Recombinant Mouse Map2k1 Protein, His/GST-tagged, FITC conjugated | +Inquiry |
FOLR1-250R | Recombinant Rhesus macaque FOLR1 Protein, His-tagged | +Inquiry |
TEX2-5749Z | Recombinant Zebrafish TEX2 | +Inquiry |
SLCO1A6-5594R | Recombinant Rat SLCO1A6 Protein | +Inquiry |
G3BP2-5064Z | Recombinant Zebrafish G3BP2 | +Inquiry |
◆ Native Proteins | ||
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
USF1-480HCL | Recombinant Human USF1 293 Cell Lysate | +Inquiry |
CDH17-2032HCL | Recombinant Human CDH17 cell lysate | +Inquiry |
WDR34-1926HCL | Recombinant Human WDR34 cell lysate | +Inquiry |
PRKAR2B-2860HCL | Recombinant Human PRKAR2B 293 Cell Lysate | +Inquiry |
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FACE1 Products
Required fields are marked with *
My Review for All FACE1 Products
Required fields are marked with *
0
Inquiry Basket