Recombinant Full Length Arabidopsis Thaliana Atp-Dependent Zinc Metalloprotease Ftsh 3, Mitochondrial(Ftsh3) Protein, His-Tagged
Cat.No. : | RFL30066AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 3, mitochondrial(FTSH3) Protein (Q84WU8) (84-809aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (84-809) |
Form : | Lyophilized powder |
AA Sequence : | SDEAPKKKNYENYFPKDKQEPKSDQKSEHKEGSEKNENENVGDMFMNRFQNLLIPLLALA VFFSTFSFGSGEQQQISFQEFKNKLLEPGLVDHIDVSNKSVAKVYVRSTPKDQQTTDVVH GNGNGIPAKRTGGQYKYYFNIGSVDSFEEKLEEAQEALGVDRHEYVPVTYVSEMVWYQEF MRFAPTLLLLGTLIYGARRMQGGLGVGGTGGKNGRGIFNIGKATITRADKHSKNKIYFKD VAGCDEAKQEIMEFVHFLKNPKKYEDLGAKIPKGALLVGPPGTGKTLLAKATAGESGVPF LSISGSDFMEMFVGVGPSRVRHLFQEARQAAPSIIFIDEIDAIGRARGRGGLGGNDERES TLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQIFKI YLKKIKLDHEPSYYSQRLAALTPGFAGADIANVCNEAALIAARHEGATVTMAHFESAIDR VIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVP NENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKV GLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVAEIAELLL EKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDDGAPPPFE PQVVPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FTSH3 |
Synonyms | FTSH3; At2g29080; T9I4.16; ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; AtFTSH3 |
UniProt ID | Q84WU8 |
◆ Recombinant Proteins | ||
KRTAP11-1-5798HF | Recombinant Full Length Human KRTAP11-1 Protein, GST-tagged | +Inquiry |
FXC1-5270HF | Recombinant Full Length Human FXC1 Protein, GST-tagged | +Inquiry |
trxA-5419S | Recombinant Shigella flexneri trxA Protein (Met1-Ala109), C-His tagged | +Inquiry |
RFL11425MF | Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
CGREF1-1617M | Recombinant Mouse CGREF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TF-261M | Native Monkey Transferrin | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
C9orf91-7919HCL | Recombinant Human C9orf91 293 Cell Lysate | +Inquiry |
MACROD2-4571HCL | Recombinant Human MACROD2 293 Cell Lysate | +Inquiry |
DEFB126-6982HCL | Recombinant Human DEFB126 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FTSH3 Products
Required fields are marked with *
My Review for All FTSH3 Products
Required fields are marked with *
0
Inquiry Basket