Recombinant Full Length Human FXC1 Protein, GST-tagged

• Cat.No.: FXC1-5270HF
• Product Overview: Human FXC1 full-length ORF ( AAH11014, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 103 amino acids
• Description: FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM
• Molecular Mass: 37.07 kDa
• AA Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASTVPSVAAEQPGVSPSGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FXC1 fracture callus 1 homolog (rat) [ Homo sapiens ]
• Official Symbol: FXC1
• Synonyms: FXC1; fracture callus 1 homolog (rat); fracture callus 1 (rat) homolog; mitochondrial import inner membrane translocase subunit Tim9 B; Tim9b; TIM10B; TIMM10B; fracture callus protein 1
• Gene ID: 26515
• mRNA Refseq: NM_012192
• Protein Refseq: NP_036324
• MIM: 607388
• UniProt ID: Q9Y5J6