Recombinant Full Length Arabidopsis Thaliana Atp-Dependent Zinc Metalloprotease Ftsh 2, Chloroplastic(Ftsh2) Protein, His-Tagged
Cat.No. : | RFL22235AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 2, chloroplastic(FTSH2) Protein (O80860) (83-695aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (83-695) |
Form : | Lyophilized powder |
AA Sequence : | DEQGVSSSRMSYSRFLEYLDKDRVNKVDLYENGTIAIVEAVSPELGNRVERVRVQLPGLS QELLQKLRAKNIDFAAHNAQEDQGSVLFNLIGNLAFPALLIGGLFLLSRRSGGGMGGPGG PGNPLQFGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAVGAKIPKG VLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCI VFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSAL LRPGRFDRQVSVDVPDVKGRTDILKVHAGNKKFDNDVSLEIIAMRTPGFSGADLANLLNE AAILAGRRARTSISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAVCGTLTPGH DAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGDSEVTTG AVGDLQQITGLARQMVTTFGMSDIGPWSLMDSSAQSDVIMRMMARNSMSEKLAEDIDSAV KKLSDSAYEIALSHIKNNREAMDKLVEVLLEKETIGGDEFRAILSEFTEIPPENRVPSST TTTPASAPTPAAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FTSH2 |
Synonyms | FTSH2; VAR2; At2g30950; F7F1.16; ATP-dependent zinc metalloprotease FTSH 2, chloroplastic; AtFTSH2; Protein VARIEGATED 2 |
UniProt ID | O80860 |
◆ Native Proteins | ||
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST5-3027HCL | Recombinant Human CST5 cell lysate | +Inquiry |
EIF4G2-6646HCL | Recombinant Human EIF4G2 293 Cell Lysate | +Inquiry |
ZIK1-163HCL | Recombinant Human ZIK1 293 Cell Lysate | +Inquiry |
SCML2-2032HCL | Recombinant Human SCML2 293 Cell Lysate | +Inquiry |
FBP2-6315HCL | Recombinant Human FBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FTSH2 Products
Required fields are marked with *
My Review for All FTSH2 Products
Required fields are marked with *
0
Inquiry Basket