Recombinant Full Length Arabidopsis Thaliana Aluminum-Activated Malate Transporter 13(Almt13) Protein, His-Tagged
Cat.No. : | RFL870AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Aluminum-activated malate transporter 13(ALMT13) Protein (Q9LS23) (1-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-539) |
Form : | Lyophilized powder |
AA Sequence : | MGYKVEARSMEISMEDEDSRKKRKKGLNLPKKMKKILRNLWNVGKEDPRRVIHALKVGVA LTLVSLLYLMEPFFEGVGKNALWAVMTVVVVLEFSAGATLRKGLNRGLGTLIAGSLAFFI EWVAIHSGKILGGIFIGTSVFTIGSMITYMRFIPYIKKNYDYGMLVFLLTFNLITVSSYR VDTVIKIAHERLYTIGMGIGICLFMSLLFFPIWSGDDLHKSTITKLQGLSRCIEACVSEY FEEKLKDNETSDSESDDEDLIYNGYNTVLDSKSADEALAMYAKWEPRHTRRCNKFPSQQY IKVGSVLRKFGYTVVALHGCLQTEIQTPRSIRVLFKDPCVRLAGEICKVLSELSESIQNR RHCSSEILSDSLEAALKDLNSTIKSQPKLFLGSNLHSNITNKHLNGHVSYYNETNSNGTV SYHNDNNTNGCVLGETIEENDTVSPLPLNSVVSLSSLRSVKKSAATGEKRRLRKQLSKIA VMKSLEFSEALPFAAFASLLVEMVARLDTVIDEVEELGTIACFKEYDKTVEVRIENRLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALMT13 |
Synonyms | ALMT13; At5g46600; F10E10.8; Aluminum-activated malate transporter 13; AtALMT13 |
UniProt ID | Q9LS23 |
◆ Recombinant Proteins | ||
BBC3-946R | Recombinant Rat BBC3 Protein | +Inquiry |
RFL23455EF | Recombinant Full Length Escherichia Coli Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
SFTPC-30425TH | Recombinant Human SFTPC | +Inquiry |
RFL14273BF | Recombinant Full Length Burkholderia Mallei Translocator Protein Bipb(Bipb) Protein, His-Tagged | +Inquiry |
TMEM39A-6167R | Recombinant Rat TMEM39A Protein | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIDEC-7495HCL | Recombinant Human CIDEC 293 Cell Lysate | +Inquiry |
STMN3-1395HCL | Recombinant Human STMN3 293 Cell Lysate | +Inquiry |
BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
DUSP18-6780HCL | Recombinant Human DUSP18 293 Cell Lysate | +Inquiry |
KLRF1-1034CCL | Recombinant Cynomolgus KLRF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALMT13 Products
Required fields are marked with *
My Review for All ALMT13 Products
Required fields are marked with *
0
Inquiry Basket