Recombinant Full Length Burkholderia Mallei Translocator Protein Bipb(Bipb) Protein, His-Tagged
Cat.No. : | RFL14273BF |
Product Overview : | Recombinant Full Length Burkholderia mallei Translocator protein BipB(bipB) Protein (A2S1Q0) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Mallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MSSGVQGGPAANANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKRYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bipB |
Synonyms | bipB; BMA10229_2071; Translocator protein BipB |
UniProt ID | A2S1Q0 |
◆ Recombinant Proteins | ||
DGKZ-542HFL | Recombinant Full Length Human DGKZ Protein, C-Flag-tagged | +Inquiry |
RRM1-1318H | Recombinant Human RRM1 protein(Met1-Ser792), His&GST-tagged | +Inquiry |
RFL28075CF | Recombinant Full Length Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
SLC2A4-1644H | Recombinant Human SLC2A4 protein, His & GST-tagged | +Inquiry |
MANSC1-2738H | Recombinant Human MANSC1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMS-1651HCL | Recombinant Human SMS 293 Cell Lysate | +Inquiry |
CECR1-001HCL | Recombinant Human CECR1 cell lysate | +Inquiry |
Spleen-528D | Dog Spleen Lysate, Total Protein | +Inquiry |
VEPH1-414HCL | Recombinant Human VEPH1 293 Cell Lysate | +Inquiry |
RAB11FIP2-2629HCL | Recombinant Human RAB11FIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bipB Products
Required fields are marked with *
My Review for All bipB Products
Required fields are marked with *
0
Inquiry Basket