Recombinant Human SFTPC

• Cat.No.: SFTPC-30425TH
• Product Overview: Recombinant full length Human SFTPC with N terminal proprietary tag; Predicted MWt 47.41 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 197 amino acids
• Description: This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.
• Molecular Weight: 47.410kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVV VVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ RLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC CYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSK LGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
• Sequence Similarities: Contains 1 BRICHOS domain.

Gene Information

• Gene Name: SFTPC surfactant protein C [ Homo sapiens ]
• Official Symbol: SFTPC
• Synonyms: SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C
• Gene ID: 6440
• mRNA Refseq: NM_001172357
• Protein Refseq: NP_001165828
• MIM: 178620
• Uniprot ID: P11686
• Chromosome Location: 8p21
• Function: protein homodimerization activity