Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_2036 (Aq_2036) Protein, His-Tagged
Cat.No. : | RFL19374AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized protein aq_2036 (aq_2036) Protein (O67827) (1-216aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-216) |
Form : | Lyophilized powder |
AA Sequence : | MRKLISLILVIIFPYISLGLSARIAFSEKFIEWEYSRKNFPEDRWGMEKEERLKLAKLGL KAVISDKGMEEFKKARLKNGKRAFTDREVKHMEDVKRFLSFFFPSVYVLSIIWIAGVFLL RSFDVLIWSGIFNSLLLLFLGILTFTNYEKAFELFHNVVFDPYSWKFRYSDTLIRIYPMK FWYDGTLFVAILSFLFGILVLFTGILGKKFLKGKGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_2036 |
Synonyms | aq_2036; Uncharacterized protein aq_2036 |
UniProt ID | O67827 |
◆ Native Proteins | ||
Lectin-1839S | Active Native Sambucus Nigra Lectin Protein, Cy3 labeled | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPC4AP-743HCL | Recombinant Human TRPC4AP 293 Cell Lysate | +Inquiry |
Kidney-858R | Mini Rabbit Kidney Membrane Lysate, Total Protein | +Inquiry |
SRD5A1-1690HCL | Recombinant Human SRD5A1 cell lysate | +Inquiry |
MME-1800HCL | Recombinant Human MME cell lysate | +Inquiry |
IRAK1-5173HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_2036 Products
Required fields are marked with *
My Review for All aq_2036 Products
Required fields are marked with *
0
Inquiry Basket