Recombinant Full Length Human Olfactory Receptor 56B4(Or56B4) Protein, His-Tagged
Cat.No. : | RFL14236HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 56B4(OR56B4) Protein (Q8NH76) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETV LHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGI FLCMAVDRYIAICRPLQYPSIVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEI EHCLCSNLGVISLACDDITVNKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAM SKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRM HKLRLGFQRLLGLGQDVSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR56B4 |
Synonyms | OR56B4; Olfactory receptor 56B4; Olfactory receptor OR11-67 |
UniProt ID | Q8NH76 |
◆ Recombinant Proteins | ||
IK-2224R | Recombinant Rhesus monkey IK Protein, His-tagged | +Inquiry |
2210016L21Rik-1398M | Recombinant Mouse 2210016L21Rik Protein, Myc/DDK-tagged | +Inquiry |
TNFSF13-1045H | Active Recombinant Human TNFSF13 protein, HA-tagged | +Inquiry |
KLC3-3281H | Recombinant Human KLC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL24863MF | Recombinant Full Length Pyrophosphate-Energized Proton Pump 1(Hppa1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
IgG-147R | Native Rabbit IgG Fab fragment | +Inquiry |
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROC-747MCL | Recombinant Mouse PROC cell lysate | +Inquiry |
SLC1A6-600HCL | Recombinant Human SLC1A6 lysate | +Inquiry |
FAM104B-6460HCL | Recombinant Human FAM104B 293 Cell Lysate | +Inquiry |
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
MSL2-4114HCL | Recombinant Human MSL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR56B4 Products
Required fields are marked with *
My Review for All OR56B4 Products
Required fields are marked with *
0
Inquiry Basket