Recombinant Full Length Anopheles Gambiae Odorant Receptor Or2(Or2) Protein, His-Tagged
Cat.No. : | RFL17168AF |
Product Overview : | Recombinant Full Length Anopheles gambiae Odorant receptor Or2(OR2) Protein (Q8WTE6) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anopheles gambiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MLIEECPIIGVNVRVWLFWSYLRRPRLSRFLVGCIPVAVLNVFQFLKLYSSWGDMSELII NGYFTVLYFNLVLRTSFLVINRRKFETFFEGVAAEYALLEKNDDIRPVLERYTRRGRMLS ISNLWLGAFISACFVTYPLFVPGRGLPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACCM YIPFTSFYATCTLFALVQIAALKQRLGRLGRHSGTMASTGHSAGTLFAELKECLKYHKQI IQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLLSISNQLAQMIMIGSYIFMILSQMFAFY WHANEVLEQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQ KLLNVSYSYFTLLRRVYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2 |
Synonyms | OR2; AGAP009519; Odorant receptor Or2; AgOr2 |
UniProt ID | Q8WTE6 |
◆ Native Proteins | ||
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC17-194HCL | Recombinant Human ZDHHC17 293 Cell Lysate | +Inquiry |
NIH3T3-051WCY | Mouse embryonic fibroblast cell line NIH 3T3 Whole cell Lysate | +Inquiry |
ZNF581-43HCL | Recombinant Human ZNF581 293 Cell Lysate | +Inquiry |
STAMBP-1428HCL | Recombinant Human STAMBP 293 Cell Lysate | +Inquiry |
SPI1-1683HCL | Recombinant Human SPI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR2 Products
Required fields are marked with *
My Review for All OR2 Products
Required fields are marked with *
0
Inquiry Basket