Recombinant Full Length Anopheles Gambiae Innexin Shaking-B(Shakb) Protein, His-Tagged
Cat.No. : | RFL18625AF |
Product Overview : | Recombinant Full Length Anopheles gambiae Innexin shaking-B(shakB) Protein (Q7PXN1) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anopheles gambiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MLDIFRGLKSLVKISHVNTDSPVFRLHYSITVIILMSFSLIVTTRQYVGNPIDCVHTKDI PADVLNTYCWIHSTFALKSLFLKEVGKDVPYPGVGNSAEATAADKKIYKYYQWVCFCLFF QAILFYTPRWLWKSWEGGKIHALMMDLDIGICSEIEKKQKKKLLLDYLWDNLRYHNWWAY RYYVCEFLSLCNVIGQMFLMNRFFDGEFMTFGLDVITHMEADQEDRMDPMIYIFPRMTKC TFYKYGVSGEVERHDAICILPLNVVNEKIYIFLWFWFIILTILTTLTIFYRIIIIFSPRM RVYLLRLRFRLVRRDAIEIIVRRSKMGDWFLLYRLGENLDSIIFRDVMQDLANRLHNNQH HRVPGMKGEIQDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | shakB |
Synonyms | shakB; AGAP001487; Innexin shaking-B |
UniProt ID | Q7PXN1 |
◆ Recombinant Proteins | ||
MAGEE1-9457M | Recombinant Mouse MAGEE1 Protein | +Inquiry |
SH-RS08090-5317S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS08090 protein, His-tagged | +Inquiry |
Fkbp10-1290M | Recombinant Mouse Fkbp10 protein, His-tagged | +Inquiry |
ST3GAL2-4498R | Recombinant Rhesus monkey ST3GAL2 Protein, His-tagged | +Inquiry |
HA-575H | Recombinant Influenza A H3N2 (A/Darwin/9/2021) HA protein(Met1-Asp529), His-tagged | +Inquiry |
◆ Native Proteins | ||
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-Cardia-493H | Human Stomach-Cardia Membrane Lysate | +Inquiry |
LRRN1-4619HCL | Recombinant Human LRRN1 293 Cell Lysate | +Inquiry |
HOXD9-5409HCL | Recombinant Human HOXD9 293 Cell Lysate | +Inquiry |
TMED2-1025HCL | Recombinant Human TMED2 293 Cell Lysate | +Inquiry |
FANCD2OS-113HCL | Recombinant Human FANCD2OS lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All shakB Products
Required fields are marked with *
My Review for All shakB Products
Required fields are marked with *
0
Inquiry Basket