Recombinant Full Length Aedes Aegypti Innexin Shaking-B(Shakb) Protein, His-Tagged
Cat.No. : | RFL17464AF |
Product Overview : | Recombinant Full Length Aedes aegypti Innexin shaking-B(shakB) Protein (Q1DH70) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aedes Aegypti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MLDIFRGLKNLVKISHVNTDSPVFRLHYSITVMILMAFSLIVTTKQYVGNPIDCVHTKDI PEEVLNTYCWIHSTYALKSLFLKKVGSEVPYPGVGNSDGKNIDKKIYKYYQWVCFCLFFQ AILFYTPRWLWKSWEGGKIHALMMDLDIGICSEIEKKQKKKLLLDYLWDNLRYHNWWAYR YYICEFLSLVNVIGQMFLMNRFFDGEFMTFGLDVITHMEADQEDRMDPMIYIFPRMTKCT FYKYGVSGEVERHDAICILPLNVVNEKIYIFLWFWFIILTILTTLTIFYRIIIIFSPRMR VYLLRLRFRLVRRDAIEIIVRRSKMGDWFLLYRLGENLDSIIFRDVMQDLANRLHNNQHH RVPGMKGEIQDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | shakB |
Synonyms | shakB; AAEL014227; Innexin shaking-B |
UniProt ID | Q1DH70 |
◆ Recombinant Proteins | ||
Angptl4-406M | Recombinant Mouse Angptl4, His-tagged | +Inquiry |
RFL29514RF | Recombinant Full Length Rhinoceros Unicornis Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
HS6ST1-6052C | Recombinant Chicken HS6ST1 | +Inquiry |
COMMD9-7180H | Recombinant Human COMM Domain Containing 9, His-tagged | +Inquiry |
RUVBL1-1814H | Recombinant Human RUVBL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
C3b-03M | Native Monkey C3b Protein | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCIAD2-3604HCL | Recombinant Human OCIAD2 293 Cell Lysate | +Inquiry |
KCNK2-97HCL | Recombinant Human KCNK2 Lysate | +Inquiry |
FAM153C-6421HCL | Recombinant Human FAM153C 293 Cell Lysate | +Inquiry |
CALHM2-7891HCL | Recombinant Human CALHM2 293 Cell Lysate | +Inquiry |
GLT1D1-715HCL | Recombinant Human GLT1D1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All shakB Products
Required fields are marked with *
My Review for All shakB Products
Required fields are marked with *
0
Inquiry Basket