Recombinant Full Length Anolis Carolinensis Red-Sensitive Opsin Protein, His-Tagged
Cat.No. : | RFL29766AF |
Product Overview : | Recombinant Full Length Anolis carolinensis Red-sensitive opsin Protein (P41592) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anolis carolinensis (Green anole) (American chameleon) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MAGTVTEAWDVAVFAARRRNDEDDTTRDSLFTYTNSNNTRGPFEGPNYHIAPRWVYNITS VWMIFVVIASIFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETVIASTISVINQISG YFILGHPMCVLEGYTVSTCGISALWSLAVISWERWVVVCKPFGNVKFDAKLAVAGIVFSW VWSAVWTAPPVFGWSRYWPHGLKTSCGPDVFSGSDDPGVLSYMIVLMITCCFIPLAVILL CYLQVWLAIRAVAAQQKESESTQKAEKEVSRMVVVMIIAYCFCWGPYTVFACFAAANPGY AFHPLAAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSTSRTEVSS VSNSSVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Anolis carolinensis Red-sensitive opsin |
Synonyms | Red-sensitive opsin; Red cone photoreceptor pigment |
UniProt ID | P41592 |
◆ Recombinant Proteins | ||
CUL4B-1120HFL | Recombinant Full Length Human CUL4B protein, Flag-tagged | +Inquiry |
RFL5578HF | Recombinant Full Length Disulfide Bond Formation Protein B(Dsbb) Protein, His-Tagged | +Inquiry |
Ace-512M | Recombinant Mouse Ace protein, His & MBP-tagged | +Inquiry |
PDCD1-190H | Active Recombinant Human PDCD1 Protein, His-tagged | +Inquiry |
CPB1-6088Z | Recombinant Zebrafish CPB1 | +Inquiry |
◆ Native Proteins | ||
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS8-4763HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
NGFR-1679MCL | Recombinant Mouse NGFR cell lysate | +Inquiry |
EXOSC2-6503HCL | Recombinant Human EXOSC2 293 Cell Lysate | +Inquiry |
AASDH-1HCL | Recombinant Human AASDH cell lysate | +Inquiry |
RSPH3-2129HCL | Recombinant Human RSPH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Anolis carolinensis Red-sensitive opsin Products
Required fields are marked with *
My Review for All Anolis carolinensis Red-sensitive opsin Products
Required fields are marked with *
0
Inquiry Basket