Recombinant Full Length Ammi Majus Psoralen Synthase(Cyp71Aj1) Protein, His-Tagged
Cat.No. : | RFL18295AF |
Product Overview : | Recombinant Full Length Ammi majus Psoralen synthase(CYP71AJ1) Protein (Q6QNI4) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ammi majus (Bishop's weed) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MKMLEQNPQYLYFFSLFLVTIFLYKWLTLKKTPLKNLPPSPPQYPIIGNLHQIGPDPQAS LRDLAQKYGPLMFLKFGTVPVLVVSSADAAREALKTHDLVFADRPYSSVANKIFYNGKDM VFARYTEYWRQVKSICVTQLLSNKRVNSFHYVREEEVDLLVQNLENSHSKVANLTELLIE VTGNVVCRVSVGSGDKVDSYKILILEIMDMLGYSRSIEDFFPLLGWVDWLTGLRGKVAEA AKGVDTFLEGVLKEHLSTTGSKYNDFVSILLEIQEADAGSSMDNECIKSLIWDMLGAGTE TISTALEWTLAALIKNPDAMFKLQNEVREIGKGKSKISEADLVKMNYLQAVMKESMRLYF TAPLLVPREARQDIKFMGYDISSGTQVLINAWAIARDPLLWDKPEEFRPERFLNSPIDYK GFHYEFLPFGAGRRGCPGIQFAMCINELVVANLVHKFNFELPDGKRLEDLDMTAASGITL RKKSPLLVVARPHV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP71AJ1 |
Synonyms | CYP71AJ1; Psoralen synthase; Cytochrome P450 CYP71AJ1 |
UniProt ID | Q6QNI4 |
◆ Recombinant Proteins | ||
KRT73-875H | Recombinant Human KRT73 Protein, His-tagged | +Inquiry |
Il1a-545M | Recombinant Mouse Il1a protein | +Inquiry |
MENA-2146B | Recombinant Bacillus subtilis MENA protein, His-tagged | +Inquiry |
UBE3A-1463H | Recombinant Human UBE3A protein, His-tagged | +Inquiry |
AYP1020-RS05420-6018S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS05420 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP7-7833HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
OLR1-1716HCL | Recombinant Human OLR1 cell lysate | +Inquiry |
VNN1-1583MCL | Recombinant Mouse VNN1 cell lysate | +Inquiry |
B3GALTL-1103HCL | Recombinant Human B3GALTL cell lysate | +Inquiry |
PLA2G6-3139HCL | Recombinant Human PLA2G6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP71AJ1 Products
Required fields are marked with *
My Review for All CYP71AJ1 Products
Required fields are marked with *
0
Inquiry Basket