Recombinant Full Length Alcaligenes Xylosoxydans Xylosoxydans Nickel-Cobalt-Cadmium Resistance Protein Nccb(Nccb) Protein, His-Tagged
Cat.No. : | RFL31980AF |
Product Overview : | Recombinant Full Length Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccB(nccB) Protein (Q44585) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MMTKNERRQPSWPMIAGVAAAAALVGFGAARGLGSPSGAEVSKLAAAPEKAAASAPAAEP AEVRIPGEYLAAANIAVEPVSAGGVGSVLLAPASVAAVPGSEAVIASRAAGAVLRIQRKL GDAVRAGDVLALVDSPEAAAMAAERKVAQARADLARKTYERESSLFQQGVTPRQEMESAR IALDVAQAEVQRAATVAQAAKVSSDGRSVAVVSPIAGRITAQSVTLGAYVAPQAELFRVA GSGAVQVEAYVTAADTSRIAAGSDATIVLANGAPLAGRVQAVTPTVSGSARAATVVVTPV DANSGLIVGEGVQVRLHTKAADANAMSVPEDAVQNLDGRDVVFVRTQQGFRPKSVLVGSR SGGVAQILSGVKPGEQVATRNAFLIKAEMNKAGGDDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nccB |
Synonyms | nccB; Nickel-cobalt-cadmium resistance protein NccB |
UniProt ID | Q44585 |
◆ Recombinant Proteins | ||
MINOS1-7254Z | Recombinant Zebrafish MINOS1 | +Inquiry |
FOXR2-5112HF | Recombinant Full Length Human FOXR2 Protein, GST-tagged | +Inquiry |
KPHS_15150-162K | Recombinant Klebsiella pneumoniae KPHS_15150 Protein | +Inquiry |
RFL28285PF | Recombinant Full Length Pongo Pygmaeus Taste Receptor Type 2 Member 5(Tas2R5) Protein, His-Tagged | +Inquiry |
MIF-23H | Recombinant Human MIF protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM37-955HCL | Recombinant Human TMEM37 293 Cell Lysate | +Inquiry |
ATOH1-8617HCL | Recombinant Human ATOH1 293 Cell Lysate | +Inquiry |
DHX58-984HCL | Recombinant Human DHX58 cell lysate | +Inquiry |
C4orf26-117HCL | Recombinant Human C4orf26 lysate | +Inquiry |
NTM-3668HCL | Recombinant Human NTM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nccB Products
Required fields are marked with *
My Review for All nccB Products
Required fields are marked with *
0
Inquiry Basket