Recombinant Full Length Human FOXR2 Protein, GST-tagged

• Cat.No.: FOXR2-5112HF
• Product Overview: Human FOXR2 full-length ORF ( AAH12934, 1 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FOXR2 (Forkhead Box R2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXR1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 59.95 kDa
• Protein length: 311 amino acids
• AA Sequence: MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXR2 forkhead box R2 [ Homo sapiens ]
• Official Symbol: FOXR2
• Synonyms: FOXR2; forkhead box R2; forkhead box protein R2; FOXN6; MGC21658; forkhead box protein N6
• Gene ID: 139628
• mRNA Refseq: NM_198451
• Protein Refseq: NP_940853
• MIM: 300949
• UniProt ID: Q6PJQ5