Recombinant Full Length Agrobacterium Tumefaciens Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL25547AF |
Product Overview : | Recombinant Full Length Agrobacterium tumefaciens Protein virB10(virB10) Protein (P17800) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium Fabrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MNDDNQQSAHDVDASGSLVSDTHHRRLSGAQKLIVGGVVLALSLSLIWLGGREKKENGDA PPSTMIATNTKPFHPAPIDVTLDPPAAQEAVQPTAPPPARSEPERHEPRPEETPIFAYTS GDQGTSKRVQQGETDRRREGNGEDSPLPKVEVSAENDLSIRMKPTELQPTRATLLPHPDF MVTEGTIIPCILQTAIDTSLAGYVKCVLPWDVRGTTNNVVLLDRGTTVVGEIQRGLQQGD ARVFVLWDRAETPDHAMISLASPSADELGRSGLPGTVDNHFWQRFSGAMLLSVVQGAFQA ASTYAGSSGGGTSFNSVQNNGEQTADTALKATINIPPTLKKNQGDTVSIFVARDLDFSGI YQLRMAGRAARGRDRRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; Atu6176; AGR_pTi_13; Protein virB10 |
UniProt ID | P17800 |
◆ Recombinant Proteins | ||
EPHA2-300H | Recombinant Human EPH Receptor A2, GST-tagged, Active | +Inquiry |
KLK2-152H | Active Recombinant Human KLK2 protein, His-tagged | +Inquiry |
TEX14-9141M | Recombinant Mouse TEX14 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF11-1529H | Recombinant Human TNFSF11 protein, His-tagged | +Inquiry |
SE0411-3116S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0411 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-5401B | Native Bovine Coagulation Factor II (thrombin) | +Inquiry |
Lectin-1862W | Active Native Wheat Germ Agglutinin Protein, Rhodamine labeled | +Inquiry |
PLG-252H | Active Native Human Plasminogen | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHD-979HCL | Recombinant Human LDHD cell lysate | +Inquiry |
ADCY8-9020HCL | Recombinant Human ADCY8 293 Cell Lysate | +Inquiry |
ECHDC3-6729HCL | Recombinant Human ECHDC3 293 Cell Lysate | +Inquiry |
PKNOX1-3148HCL | Recombinant Human PKNOX1 293 Cell Lysate | +Inquiry |
WFDC11-321HCL | Recombinant Human WFDC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket