Recombinant Full Length African Swine Fever Virus Major Structural Protein P17 (Pret-119) Protein, His-Tagged
Cat.No. : | RFL27435AF |
Product Overview : | Recombinant Full Length African swine fever virus Major structural protein p17 (Pret-119) Protein (P0C9Y9) (1-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | African swine fever virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-117) |
Form : | Lyophilized powder |
AA Sequence : | MDTETSPLLSHNLSTREGIKQSTQGLLAHTIAKYPGTTAILLGILILLVIILIIVAIVYY NRAVDCNSNMPKPPPSYYVQQPEPHHHFPVFFRRRKNSTSQQSHIPSDEQLAELAHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pret-119 |
Synonyms | Pret-119; Major structural protein p17 |
UniProt ID | P0C9Y9 |
◆ Native Proteins | ||
KRT19-5H | Native Human CK19 | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLG4-6910HCL | Recombinant Human DLG4 293 Cell Lysate | +Inquiry |
ELF5-6630HCL | Recombinant Human ELF5 293 Cell Lysate | +Inquiry |
CEBPE-7597HCL | Recombinant Human CEBPE 293 Cell Lysate | +Inquiry |
PTPN11-1334MCL | Recombinant Mouse PTPN11 cell lysate | +Inquiry |
C12orf36-8322HCL | Recombinant Human C12orf36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pret-119 Products
Required fields are marked with *
My Review for All Pret-119 Products
Required fields are marked with *
0
Inquiry Basket