Recombinant Full Length Aeromonas Salmonicida Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL7319AF |
Product Overview : | Recombinant Full Length Aeromonas salmonicida Membrane protein insertase YidC(yidC) Protein (A4STS5) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aeromonas Salmonicida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MESQRNLILIGLLFVSFLLWQQWESDKAPKPAPTTVAQTEHFVPEAGQTGDIPQVSEQAN ANAARKLITVSSDVLKLTLDTQGGDIVSAELLAHKLEEGKDQSFVLLTSQPDRLYVAQSG LVGRDGPDSQAQGRPTYEAAQTSYQLADGQDQVVVPMTWTDSKGVVFTKEFVLKRGDYAI GVDYKIDNKSAEPVQVQFYGQLKQTVTTPKDQEGHAMVASAYRGGAFSSEESRYKKYTFD EMKDADLNKTTKGGWVAMLQHYFVSAWAPNADDTNSFYSRVIPGKDQAIIGYKAPLVDVA AGQQAEVTSKLWVGPKLQDQMAKVANHLDLTVDYGWLWFIAQPLHWLLTVFQGFVHNWGV AIIMLTLLVRGIMFPLTKAQYTSMAKMRMLQPKLAALKERFSDDRQKMSQGMMELYKKEK VNPLGGCLPILVQMPIFIALYWALMESVELRHAPFALWITDLSVKDPFFVLPILMGASMW YLQKMSPTTITDPMQQKVMQFMPIIFTFMFLWFPAGLTLYWLVSNVISITQQTIIYRQLE KKGLHTRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; ASA_4382; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | A4STS5 |
◆ Native Proteins | ||
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
Lecithin-09E | Native Egg Yolk Lecithin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
MAP2K1-001MCL | Recombinant Mouse MAP2K1 cell lysate | +Inquiry |
RING1-2337HCL | Recombinant Human RING1 293 Cell Lysate | +Inquiry |
ADH5-30HCL | Recombinant Human ADH5 cell lysate | +Inquiry |
F7-001MCL | Recombinant Mouse F7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket