Recombinant Full Length Shewanella Baltica Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL2597SF |
Product Overview : | Recombinant Full Length Shewanella baltica Membrane protein insertase YidC(yidC) Protein (B8EDW5) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella baltica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MESQRNILLIGLLFVSFLLWQQWQADKAPKPVATESSLVANAANSHSADVPEADTGVPAA VTATSKLITVKTDQLDVQINPIGGDIVFAALVSHKMEQDKDQPFVLLEQTKDFTYIAQSG LIGRDGIDSSAKGRAAFSTAATEYTLAEGQDTLEVPLTYVADNGVTYTKVFVFHRGKFNV DVDYKINNTSAAPLQVQMYGQIKQTIKPSESSMVMPTYRGGAFSTQDVRYEKYKFDDMAK SNLNQATLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLANIGFRGAVYDIAPGATQ EISSQFYVGPKDQKALSAISDTLNLVVDYGFLWWLAVPIHWLLMFYQSFVGNWGMAIILI TLTVRGLLFPLTKAQYTSMAKMRNLQPKLTDLKERFGDDRQKMGQAMMELYKKEKVNPMG GCLPIILQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYYILPLLMGVSMFVMQKM QPIAPTMDPMQVKMMQWMPVIFTVFFLWFPAGLVLYWLVGNIVAITQQKIIYAGLAKKGL K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Sbal223_4325; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B8EDW5 |
◆ Recombinant Proteins | ||
LIAI-0379B | Recombinant Bacillus subtilis LIAI protein, His-tagged | +Inquiry |
HSP90AB1-3471H | Recombinant Human HSP90AB1 Protein (Met1-Asp724), His tagged | +Inquiry |
SCARB1-852H | Recombinant Human Scavenger Receptor Class B, Member 1, Fc-His | +Inquiry |
TRIM68-21HFL | Recombinant Full Length Human tripartite motif containing 68 Protein, GST tagged | +Inquiry |
PRR14-13468M | Recombinant Mouse PRR14 Protein | +Inquiry |
◆ Native Proteins | ||
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN14-02HCL | Recombinant Human CAPN14 HEK293T cell lysate | +Inquiry |
UHRF1-508HCL | Recombinant Human UHRF1 293 Cell Lysate | +Inquiry |
FOXJ1-663HCL | Recombinant Human FOXJ1 cell lysate | +Inquiry |
ICAM3-2417HCL | Recombinant Human ICAM3 Overexpression Lysate(Met 1-His 485) | +Inquiry |
GYPB-313HCL | Recombinant Human GYPB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket