Recombinant Full Length Adenylate Cyclase 1(Cyaa) Protein, His-Tagged
Cat.No. : | RFL23724SF |
Product Overview : | Recombinant Full Length Adenylate cyclase 1(cyaA) Protein (P40137) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Stigmatella aurantiaca |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MMDAAGRTTQETLARTLESEQGHNALNLSWVRLLATSAVLIVSLYFGRVRGMTDWDVYTP PFAAYWSVTALTLVALYRFERLRRWAGLSLALVDVPAIYWLQHIALPLSPSPGGVAGFTL GLYATLILLSALSLRRTMTLVVTACAAVGEVALQREAHISLGAQLTAVVVLGACAAGACH LLLRIRTLLTTATQQELKRARLGRYFSPAVAERLQDLDRSETSPELREVTLLFADIRDFT SLSERLRPEQVVTLLNEYYGRMVEVVFRHGGTLDKFIGDALMVYFGAPIADPAHARRGVQ CALDMVQELETVNALRSARGEPCLRIGVGVHTGPAVLGNIGSATRRLEYTAIGDTVNLAS RIESLTKTRDVPILASRATREQAGDTFLWNEMAPASVPGKSQPVAIFTPRNRTPAQQAGA PAAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cyaA |
Synonyms | cyaA; Adenylate cyclase 1; ATP pyrophosphate-lyase 1; Adenylyl cyclase 1; AC 1 |
UniProt ID | P40137 |
◆ Recombinant Proteins | ||
Elac1-520M | Recombinant Mouse Elac1 Protein, MYC/DDK-tagged | +Inquiry |
PWWP2A-7311M | Recombinant Mouse PWWP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINE3-445H | Recombinant Human SERPINE3 protein, His-tagged | +Inquiry |
ANXA6-02H | Recombinant Human ANXA6 Protein, Fc/His-tagged | +Inquiry |
DLK1-001H | Recombinant Human DLK1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C1q-04M | Native Mouse C1q Protein | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1R-8133HCL | Recombinant Human C1R 293 Cell Lysate | +Inquiry |
PC-12-2144R | PC-12 (rat adrenal gland pheochromocytoma) whole cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
GNL3-5847HCL | Recombinant Human GNL3 293 Cell Lysate | +Inquiry |
MFSD8-4344HCL | Recombinant Human MFSD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cyaA Products
Required fields are marked with *
My Review for All cyaA Products
Required fields are marked with *
0
Inquiry Basket