Recombinant Full Length Acidithiobacillus Ferrooxidans Probable Intracellular Septation Protein A (Lferr_0816) Protein, His-Tagged
Cat.No. : | RFL23400AF |
Product Overview : | Recombinant Full Length Acidithiobacillus ferrooxidans Probable intracellular septation protein A (Lferr_0816) Protein (B5ENN2) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acidithiobacillus ferrooxidans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGMLAITVIFVLFQAVVISRALPQEAKD GDSSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lferr_0816 |
Synonyms | yciB; Lferr_0816; Inner membrane-spanning protein YciB |
UniProt ID | B5ENN2 |
◆ Recombinant Proteins | ||
NR1H4-3066H | Active Recombinant Human NR1H4, His-tagged | +Inquiry |
SNRPB-2061H | Recombinant Human SNRPB Protein, His (Fc)-Avi-tagged | +Inquiry |
CSNK1G2-2195HF | Recombinant Full Length Human CSNK1G2 Protein, GST-tagged | +Inquiry |
APOL3-366H | Recombinant Human APOL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OR51D1-1692H | Recombinant Human OR51D1 | +Inquiry |
◆ Native Proteins | ||
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
LDH-17H | Active Native Human Lactate Dehydrogenase | +Inquiry |
LYZ-27700TH | Native Human LYZ | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM230-8115HCL | Recombinant Human C20orf30 293 Cell Lysate | +Inquiry |
USP21-465HCL | Recombinant Human USP21 293 Cell Lysate | +Inquiry |
KLHL1-4915HCL | Recombinant Human KLHL1 293 Cell Lysate | +Inquiry |
Adrenal-80M | Mouse Adrenal Tissue Lysate | +Inquiry |
CYP46A1-7105HCL | Recombinant Human CYP46A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lferr_0816 Products
Required fields are marked with *
My Review for All Lferr_0816 Products
Required fields are marked with *
0
Inquiry Basket