Recombinant Full Length Abies Alba Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL35829AF |
Product Overview : | Recombinant Full Length Abies alba Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q8HB52) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Abies alba (Edeltanne) (European silver fir) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTIALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEIVDTFPYFVSGVLHLISSAVLGFGGIYHAL IGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGAGAFLLVLKALYFGGVYDTWAPGGG DVRKITNPTLNPSAIFGYLLKSPFGGEGWIVSVDNLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRAFVWSGEAYLSYSLAALSLFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGASVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLSKLRKDIQPWQERRSAEYMTHAPLGSSNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFLFIGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q8HB52 |
◆ Recombinant Proteins | ||
TIGD7-4529R | Recombinant Rhesus Macaque TIGD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABO-3794H | Recombinant Human ABO protein, GST-tagged | +Inquiry |
Amtn-3432M | Recombinant Mouse Amtn protein, His-tagged | +Inquiry |
IL1R1-368H | Recombinant Human IL1R1 Protein, His-tagged | +Inquiry |
RFL29863MF | Recombinant Full Length Mouse High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha(Fcer1A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F9-26523TH | Native Human F9 | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adrenal-633B | Bovine Adrenal Whole Lysate, Total Protein | +Inquiry |
PRIMPOL-7789HCL | Recombinant Human CCDC111 293 Cell Lysate | +Inquiry |
MTIF3-4079HCL | Recombinant Human MTIF3 293 Cell Lysate | +Inquiry |
Ovary-40H | Human Ovary Tumor Tissue Lysate | +Inquiry |
CYP17A1-7128HCL | Recombinant Human CYP17A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket