Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL20646CF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q9TM46) (1-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanidium caldarium (Red alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-460) |
Form : | Lyophilized powder |
AA Sequence : | MLFNKDKNNIGGRSIESTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWTGAMTLFETS HFIPEKPLYEQGMILLPHLATLGWGVAPGGEIVNTYPYFATGVIHLVSSAVLGFGGIYHS IVGPDVLEDSFSFFGYDWRDKNKMTTILGIHLILLGIGAFLLVIKALFIGGIYDTWAPGG GDIRFITNPTLNPAIIFSYLLKSPFGGEGWIVGVNNMEDVIGGHIWIGVTCVIGGIWHIL TRPFSWARRAFVWSGEAYLSYSLGALALMGQTAAEYAWYNNTVYPSEFYGPTAAEASQAQ AFTFLVRDQRLGANIASTQGPTGLGKYLMRSPTGEVILGGETMRFWDLRAPWLEPLRSSN GLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFL GFFIFIGHLWHAGRARAAAAGFEKGINRENEPVLSMRPLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q9TM46 |
◆ Recombinant Proteins | ||
CD27-54HF | Recombinant Full Length Human CD27 Protein | +Inquiry |
LGALS8-4441H | Recombinant Human LGALS8 Protein (Met2-Trp317), N-His tagged | +Inquiry |
NET1-1843Z | Recombinant Zebrafish NET1 | +Inquiry |
KMO-016H | Recombinant Full Length Human kynurenine 3-monooxygenase Protein, Avi&Flag tagged | +Inquiry |
FCN1-4764HF | Recombinant Full Length Human FCN1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP5-8939HCL | Recombinant Human AKAP5 293 Cell Lysate | +Inquiry |
ENO1P1-556HCL | Recombinant Human ENO1P1 cell lysate | +Inquiry |
Placenta-385R | Rat Placenta Lysate | +Inquiry |
Skeletal Muscle-427R | Rabbit Skeletal Muscle Lysate | +Inquiry |
TNFRSF18-1143HCL | Recombinant Human TNFRSF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket