Recombinant Fruit Fly RPL10 Protein (1-218 aa), His-tagged
Cat.No. : | RPL10-2590F |
Product Overview : | Recombinant Fruit Fly (Drosophila melanogaster) RPL10 Protein (1-218 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Fruit Fly |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.5 kDa |
Protein length : | 1-218 aa |
AA Sequence : | MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RpL10 Ribosomal protein L10 [ Drosophila melanogaster (fruit fly) ] |
Official Symbol | RPL10 |
Synonyms | RpL10; anon-EST:Posey179; BcDNA:LD24589; CG17521; Dmel\CG17521; DQM; L10; qm; Qm; Rp L10; |
Gene ID | 43864 |
mRNA Refseq | NM_001275304 |
Protein Refseq | NP_001262233 |
UniProt ID | O61231 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RPL10 Products
Required fields are marked with *
My Review for All RPL10 Products
Required fields are marked with *
0
Inquiry Basket