Recombinant Escherichia coli TRXA Protein (2-109 aa), His-tagged

Cat.No. : TRXA-1314E
Product Overview : Recombinant Escherichia coli (strain K12) TRXA Protein (2-109 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 2-109 aa
Description : Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 15.7 kDa
AA Sequence : SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name trxA thioredoxin 1 [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol TRXA
Synonyms dasC; ECK3773; fipA; tsnC;
Gene ID 948289
Protein Refseq NP_418228
UniProt ID P0AA25

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Txn1 Products

Required fields are marked with *

My Review for All Txn1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon