Recombinant Escherichia coli ACPP Protein (1-78 aa), His-SUMO-tagged
Cat.No. : | ACPP-2262E |
Product Overview : | Recombinant Escherichia coli ACPP Protein (1-78 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-78 aa |
Description : | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | acpP acyl carrier protein [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | ACPP |
Synonyms | acpP; ECK1080; |
Gene ID | 944805 |
Protein Refseq | NP_415612 |
UniProt ID | P0A6A8 |
◆ Recombinant Proteins | ||
ACPP-951M | Recombinant Mouse ACPP Protein, His-tagged | +Inquiry |
Acpp-042M | Active Recombinant Mouse Acpp Protein, His-tagged | +Inquiry |
ACPP-0310B | Recombinant Bacillus subtilis ACPP protein, His-tagged | +Inquiry |
ACPP-9311H | Recombinant Human ACPP, His-tagged | +Inquiry |
acpP-5478S | Recombinant Staph acpP protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACPP-1880HCL | Recombinant Human ACPP cell lysate | +Inquiry |
ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACPP Products
Required fields are marked with *
My Review for All ACPP Products
Required fields are marked with *
0
Inquiry Basket