Recombinant E. coli Cytolethal distending toxin subunit B Protein, His-SUMO/MYC-tagged
Cat.No. : | cdtB-1159E |
Product Overview : | Recombinant E. coli Cytolethal distending toxin subunit B Protein (19-269aa) was expressed in E. coli with N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 19-269 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 47.4 kDa |
AA Sequence : | DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELI WNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAM RNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTL DYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Cytolethal distending toxin subunit B |
Official Symbol | Cytolethal distending toxin subunit B |
Synonyms | Cytolethal distending toxin subunit B; cdtB; Deoxyribonuclease CdtB; CDT B |
UniProt ID | Q46669 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cytolethal distending toxin subunit B Products
Required fields are marked with *
My Review for All Cytolethal distending toxin subunit B Products
Required fields are marked with *
0
Inquiry Basket