Recombinant Horse SAA1 Protein (1-110 aa), His-tagged
Cat.No. : | SAA1-2345H |
Product Overview : | Recombinant Horse SAA1 Protein (1-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Major acute phase reactant. Apolipoprotein of the HDL complex. |
Source : | Yeast |
Species : | Horse |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.3 kDa |
Protein length : | 1-110 aa |
AA Sequence : | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SAA1 serum amyloid A1 [ Equus caballus ] |
Official Symbol | SAA1 |
Synonyms | SAA1; serum amyloid A1; serum amyloid A protein; SAA; |
Gene ID | 100034017 |
mRNA Refseq | NM_001163892 |
Protein Refseq | NP_001157364 |
UniProt ID | P19857 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket