Recombinant Dog MS4A1 protein, His&Myc-tagged

• Cat.No.: MS4A1-432D
• Product Overview: Recombinant Dog MS4A1 protein(Q3C2E2)(210-297aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: N-His&C-Myc
• ProteinLength: 210-297aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.4 kDa
• AASequence: GIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Canis lupus familiaris ]
• Official Symbol: MS4A1
• Synonyms: MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B-lymphocyte antigen CD20; membrane-spanning 4-domains subfamily A member 1; CD20
• Gene ID: 485430
• mRNA Refseq: NM_001048028
• Protein Refseq: NP_001041493