Recombinant Human MS4A1 protein(209-297aa), GST-tagged

• Cat.No.: MS4A1-533H
• Product Overview: Recombinant Human MS4A1 protein(P11836)(209-297aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 209-297aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.9 kDa
• AASequence: IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ]
• Official Symbol: MS4A1
• Synonyms: MS4A1; membrane-spanning 4-domains, subfamily A, member 1; CD20; B-lymphocyte antigen CD20; B1; Bp35; MS4A2; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; S7; CVID5; LEU-16; MGC3969
• Gene ID: 931
• mRNA Refseq: NM_021950
• Protein Refseq: NP_068769
• MIM: 112210
• UniProt ID: P11836