Recombinant Dog MERTK protein, GST-tagged

Cat.No. : Mertk-001D
Product Overview : Recombinant Dog MERTK protein with GST tag was expressed in insect cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Insect Cells
Tag : GST
Description : In case of filovirus infection, seems to function as a cell entry factor.
Molecular Mass : ~ 66.147 kDa
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKDDDDKLVIRKRIQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLRSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKEQDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDFNHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLDTGPKHIPVQILLKFMVDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMHSCWRADPLDRPTFSVLRLQLEKFLESLPEVQDKADV
Purity : ≥85 % as determined by SDS-PAGE
Storage : Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.2 mg/ml
Storage Buffer : PBS, pH 7.4
Gene Name MERTK MER proto-oncogene, tyrosine kinase [ Canis lupus familiaris (dog) ]
Official Symbol MERTK
Synonyms MERTK; MER proto-oncogene, tyrosine kinase; tyrosine-protein kinase Mer; c-mer proto-oncogene tyrosine kinase; EC 2.7.10.1
Gene ID 483060
UniProt ID J9P347

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Mertk Products

Required fields are marked with *

My Review for All Mertk Products

Required fields are marked with *

0

Inquiry Basket

cartIcon