Recombinant Dog MERTK protein, GST-tagged

• Cat.No.: Mertk-001D
• Product Overview: Recombinant Dog MERTK protein with GST tag was expressed in insect cell.

Specification

• Description: In case of filovirus infection, seems to function as a cell entry factor.
• Source: Insect cell
• Species: Dog
• Tag: GST
• Molecular Mass: ~ 66.147 kDa
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKDDDDKLVIRKRIQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLRSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKEQDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDFNHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLDTGPKHIPVQILLKFMVDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMHSCWRADPLDRPTFSVLRLQLEKFLESLPEVQDKADV
• Purity: ≥85 % as determined by SDS-PAGE
• Storage: Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.2 mg/ml
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: MERTK MER proto-oncogene, tyrosine kinase [ Canis lupus familiaris (dog) ]
• Official Symbol: MERTK
• Synonyms: MERTK; MER proto-oncogene, tyrosine kinase; tyrosine-protein kinase Mer; c-mer proto-oncogene tyrosine kinase; EC 2.7.10.1
• Gene ID: 483060
• UniProt ID: J9P347