Recombinant Dog IL31 Protein (24-159aa)

• Cat.No.: IL31-05D
• Product Overview: Recombinant Canine IL31 without tag was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Description: IL31, also known as interleukin-31, is a cytokine with an anti-parallel four-helix bundle structure in the gp130/IL-6 cytokine family. It shares several structural and functional characteristics with IL-6, Oncostatin M, LIF, and Cardiotrophin-1. This protein is mainly associated with activated T cells and is preferentially expressed by type 2 helper T cells (Th2). This protein is an inflammatory cytokine that helps trigger cell-mediated immunity against pathogens. It has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis.
• Source: HEK293
• Species: Dog
• Form: Liquid
• Molecular Mass: 15.3 kDa (136aa)
• Protein length: 24-159aa
• AA Sequence: SHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IL31 interleukin 31 [ Canis lupus familiaris (dog) ]
• Official Symbol: IL31
• Synonyms: IL31; interleukin 31; interleukin-31
• Gene ID: 100302725
• mRNA Refseq: NM_001165914
• Protein Refseq: NP_001159386
• UniProt ID: C7G0W1