Recombinant Mouse Il31 Protein, His-Tagged

• Cat.No.: Il31-01M
• Product Overview: Recombinant mouse Il31 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interleukin-31 (IL-31) s an inflammatory cytokine that helps trigger cell-mediated immunity against pathogens. It has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. It is produced by a variety of cells, namely type 2 helper (TH2) T-cells. IL-31 sends signals through a receptor complex made of IL-31RA and oncostatin M receptor β (OSMRβ) expressed in immune and epithelial cells. These signals activate three pathways: ERK1/2 MAP kinase, PI3K/AKT, and JAK1/2 signaling pathways.
• Form: Lyophilized powder
• AA Sequence: MTCSLSFGAPISKEDLRTTIDLLKQESQDLYNNYSIKQASGMSADESIQLPCFSLDREALTNISVIIAHLEKVKVLSENTVDTSWVIRWLTNISCF
  NPLNLNISVPGNTDESYDCKVFVLTVLKQFSNCMAELQAKDNTTC with polyhistidine tag at the Cterminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il31 interleukin 31 [ Mus musculus (house mouse) ]
• Official Symbol: Il31
• Synonyms: 1700013B14Rik
• Gene ID: 76399
• mRNA Refseq: NM_029594.2
• Protein Refseq: NP_083870.1
• UniProt ID: Q6EAL8