Recombinant Dog CCL17 protein(24-99aa), His-tagged

• Cat.No.: CCL17-4930D
• Product Overview: Recombinant Dog CCL17 protein(Q95N01)(24-99aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Dog
• Tag: His
• Protein length: 24-99aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 10.8 kDa
• AASequence: ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CCL17 chemokine (C-C motif) ligand 17 [ Canis lupus familiaris ]
• Official Symbol: CCL17
• Synonyms: CCL17; chemokine (C-C motif) ligand 17; C-C motif chemokine 17; CC chemokine TARC; small-inducible cytokine A17; thymus and activation-regulated chemokine; TARC
• Gene ID: 403586
• mRNA Refseq: NM_001003051
• Protein Refseq: NP_001003051