Recombinant Clostridium Botulinum PBPA Protein (663-830 aa), His-SUMO-tagged

• Cat.No.: PBPA-2169C
• Product Overview: Recombinant Clostridium Botulinum (strain Hall/ATCC 3502/NCTC 13319/Type A) PBPA Protein (663-830 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Clostridium Botulinum
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 663-830 aa
• Description: Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.2 kDa
• AA Sequence: VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: pbpA; Peptidoglycan TGase DD-transpeptidase
• UniProt ID: A5I6G4