Recombinant Full Length Buchnera Aphidicola Subsp. Baizongia Pistaciae Preprotein Translocase Subunit Sece(Sece) Protein, His-Tagged
Cat.No. : | RFL7014BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Baizongia pistaciae Preprotein translocase subunit SecE(secE) Protein (Q89B14) (1-127aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Baizongia pistaciae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-127) |
Form : | Lyophilized powder |
AA Sequence : | MIKATKLKKKYDKLKIAKWSFLGILIILFILSNHYYIKHSNIFQNILLTSLTILSTGLIF LTKSGKKFLIFTKSAIHETKLITWPNFKDTLHVTFTVIIVTILLALILWGLDNILIWFIS LITSLRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secE |
Synonyms | secE; bbp_041; Protein translocase subunit SecE |
UniProt ID | Q89B14 |
◆ Recombinant Proteins | ||
CCDC134-1307M | Recombinant Mouse CCDC134 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL3-5633H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
RFL10650SF | Recombinant Full Length Upf0397 Protein Smu_1935C(Smu_1935C) Protein, His-Tagged | +Inquiry |
ANKRD13B-2071H | Recombinant Human ANKRD13B Protein, MYC/DDK-tagged | +Inquiry |
NTRK3-1279H | Active Recombinant Human NTRK3 protein, hFc&His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
Mb-160M | Native Mouse Mb | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBC1D10C-1231HCL | Recombinant Human TBC1D10C 293 Cell Lysate | +Inquiry |
HDGFRP3-5597HCL | Recombinant Human HDGFRP3 293 Cell Lysate | +Inquiry |
GNPDA2-5842HCL | Recombinant Human GNPDA2 293 Cell Lysate | +Inquiry |
LRRC17-4648HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
UQCC1-491HCL | Recombinant Human UQCC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secE Products
Required fields are marked with *
My Review for All secE Products
Required fields are marked with *
0
Inquiry Basket