Recombinant Chimpanzee LTB protein, His-tagged
Cat.No. : | LTB-4588C |
Product Overview : | Recombinant Chimpanzee LTB protein(Q862Z7)(49-244aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Chimpanzee |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.8 kDa |
Protein length : | 49-244aa |
AA Sequence : | QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTB Products
Required fields are marked with *
My Review for All LTB Products
Required fields are marked with *
0
Inquiry Basket