Recombinant Human LTB, StrepII-tagged
| Cat.No. : | LTB-285H |
| Product Overview : | Purified human recombinant TNF-C protein (amino acids 49-244, 196 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 25.4 kDa. (Accession NP_002332; UniProt Q06643) |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. |
| Source : | Human Cells |
| Species : | Human |
| Tag : | StrepII |
| Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
| Protein length : | 49-244, 196 a.a. |
| AA Sequence : | QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAE GLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYG PLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG |
| Endotoxin : | <0.1 eu per μg protein by lal |
| Purity : | >60% by SDS-PAGE |
| Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
| Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month. |
| Gene Name | LTB lymphotoxin beta (TNF superfamily, member 3) [ Homo sapiens ] |
| Official Symbol | LTB |
| Synonyms | LTB; lymphotoxin beta (TNF superfamily, member 3); TNFC; lymphotoxin-beta; p33; TNFSF3; TNF-C; LT-beta; tumor necrosis factor C; tumor necrosis factor ligand superfamily member 3; |
| Gene ID | 4050 |
| mRNA Refseq | NM_002341 |
| Protein Refseq | NP_002332 |
| MIM | 600978 |
| UniProt ID | Q06643 |
| Chromosome Location | 6p21.3 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem; |
| Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTB Products
Required fields are marked with *
My Review for All LTB Products
Required fields are marked with *
0
Inquiry Basket
