Recombinant Human LTB, StrepII-tagged
Cat.No. : | LTB-285H |
Product Overview : | Purified human recombinant TNF-C protein (amino acids 49-244, 196 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 25.4 kDa. (Accession NP_002332; UniProt Q06643) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 49-244, 196 a.a. |
Description : | Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAE GLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYG PLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >60% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month. |
Gene Name | LTB lymphotoxin beta (TNF superfamily, member 3) [ Homo sapiens ] |
Official Symbol | LTB |
Synonyms | LTB; lymphotoxin beta (TNF superfamily, member 3); TNFC; lymphotoxin-beta; p33; TNFSF3; TNF-C; LT-beta; tumor necrosis factor C; tumor necrosis factor ligand superfamily member 3; |
Gene ID | 4050 |
mRNA Refseq | NM_002341 |
Protein Refseq | NP_002332 |
MIM | 600978 |
UniProt ID | Q06643 |
Chromosome Location | 6p21.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem; |
Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
◆ Recombinant Proteins | ||
Ltb-7122M | Recombinant Mouse Ltb protein, His-tagged | +Inquiry |
Ltb-1750R | Recombinant Rat Ltb Protein, His-tagged | +Inquiry |
LTB-9344M | Recombinant Mouse LTB Protein | +Inquiry |
LTB-1190C | Recombinant Cynomolgus LTB Protein, His-tagged | +Inquiry |
LTB-2410R | Recombinant Rhesus Macaque LTB Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTB Products
Required fields are marked with *
My Review for All LTB Products
Required fields are marked with *
0
Inquiry Basket