Recombinant Chicken EN1 Protein, His-B2M-tagged

Cat.No. : EN1-1199C
Product Overview : Recombinant Chicken EN1 Protein (1-333aa) was expressed in E. coli with N-terminal His-B2M-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Chicken
Tag : His&B2M
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 48.5 kDa
AA Sequence : MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Protein length : 1-333 a.a.
Gene Name EN1 engrailed homeobox 1 [ Gallus gallus (chicken) ]
Official Symbol EN1
Synonyms EN1; En-1; en-3; Gg-En-1; engrailed homeobox 1
Gene ID 771008
mRNA Refseq XM_001234328.4
Protein Refseq XP_001234329.4
UniProt ID Q05916

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EN1 Products

Required fields are marked with *

My Review for All EN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon