Recombinant Chicken EN1 Protein, His-B2M-tagged
Cat.No. : | EN1-1199C |
Product Overview : | Recombinant Chicken EN1 Protein (1-333aa) was expressed in E. coli with N-terminal His-B2M-tag. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Chicken |
Tag : | His&B2M |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Protein length : | 1-333 a.a. |
Gene Name | EN1 engrailed homeobox 1 [ Gallus gallus (chicken) ] |
Official Symbol | EN1 |
Synonyms | EN1; En-1; en-3; Gg-En-1; engrailed homeobox 1 |
Gene ID | 771008 |
mRNA Refseq | XM_001234328.4 |
Protein Refseq | XP_001234329.4 |
UniProt ID | Q05916 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All EN1 Products
Required fields are marked with *
My Review for All EN1 Products
Required fields are marked with *
0
Inquiry Basket