Recombinant Human PRNP Protein, Lys23-Ser230, C-His-Avi tagged, Biotinylated

• Cat.No.: PRNP-12HB
• Product Overview: Biotinylated recombinant Human PRNP Protein (Lys23-Ser230) with C-His-Avi tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Avi
• ProteinLength: Lys23-Ser230
• Description: The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.
• Conjugation/Label: Biotin
• Molecular Mass: 25 kDa
• AA Sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSHHHHHHHHGLNDIFEAQKIEWHE
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.42 mg/mL by Bradford
• Storage Buffer: Sterile 50mM tris, pH8.0, 300mM NaCl, 2mM DTT, 0.01% SKL, 20% Glycerol

Gene Information

• Gene Name: PRNP prion protein (Kanno blood group) [ Homo sapiens (human) ]
• Official Symbol: PRNP
• Synonyms: PRNP; prion protein (Kanno blood group); CJD; GSS; PrP; ASCR; KURU; PRIP; PrPc; CD230; AltPrP; p27-30; PrP27-30; PrP33-35C; major prion protein; alternative prion protein; CD230 antigen; prion-related protein
• Gene ID: 5621
• mRNA Refseq: NM_000311
• Protein Refseq: NP_000302
• MIM: 176640
• UniProt ID: P04156