Recombinant Castor bean RCOM protein, His-tagged
Cat.No. : | RCOM-6855C |
Product Overview : | Recombinant Castor bean RCOM protein(B9SLR1)(1-552aa), fused with N-terminal His tag, was expressed in vitro E.coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Castor bean |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-552aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.8 kDa |
AASequence : | MKDRRRRETVSWNRFFWCTLLLVLSCVLFTASTFREKFQPEIVSAWRQPAMEATTTIMSTNSPAKPSISIRETVMLPDQVLIFVNYPQSSRLFTKEDFSCVYFSRNSTSLSETQLKKPPNQIDGTDVNNQIVRCPLNPRGFSVSLELKSGGGYINPGPTHRWDSLVYEAMIDRDNTTVVFVKGFNLRADRIYNASKFECVYGWDFRKTKFVLRSNVISIAQEIVRCQTPLSILNNQLKVNNAIKVSIRLKGKGTLHSIARPGVQLLTDPEPGLRGEKPHEMCICTMLRNQGRFLKEWVMYHSQIGVERWFIYDNNSEDDIDSVIESLIDAKFNISRHVWPWVKAQEAGFAHCALRARGLCEWVGFIDVDEFFHLPTGLNLQDAVKNQSNSGNNVAELRVSCHSFGPSGLKHVPAQGVTVGYTCRMMLPERHKSIVKPEALNSTLINVVHHFHLRDGFRYVNADKGILVINHYKYQVWEVFKEKFYRRVATYVVDWQNEQNVGSKDRAPGLGTRAVEPPDWSSRFCEVSDTGLRDRILQNFLDPLTDLLPWQI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
APOL2-2388H | Recombinant Human APOL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLF6A-11507Z | Recombinant Zebrafish KLF6A | +Inquiry |
TGIF1-6436H | Recombinant Human TGIF1 Protein (Met150-Glu248), N-His tagged | +Inquiry |
SCO4605-576S | Recombinant Streptomyces coelicolor A3(2) SCO4605 protein, His-tagged | +Inquiry |
HA-541H | Recombinant Influenza A H1N1 (A/Mexico/InDRE4114/2009) HA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-524B | Native Bovine Collagen Type I Protein, FITC-conjugated | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SENP7-1972HCL | Recombinant Human SENP7 293 Cell Lysate | +Inquiry |
CNTN6-7391HCL | Recombinant Human CNTN6 293 Cell Lysate | +Inquiry |
KCNQ5-5016HCL | Recombinant Human KCNQ5 293 Cell Lysate | +Inquiry |
Stomach-481P | Porcine Stomach Lysate | +Inquiry |
HAS3-5632HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RCOM Products
Required fields are marked with *
My Review for All RCOM Products
Required fields are marked with *
0
Inquiry Basket