Recombinant Canine CXCL12 Protein
Cat.No. : | CXCL12-3920C |
Product Overview : | Recombinant Canine CXCL12 was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Canine |
Form : | 20 mM Tris-HCl, 0.10 M NaCl, pH 8.0 |
Molecular Mass : | ~25 kDa |
AA sequence : | MNHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNK |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
Purity : | >90%, by SDS-PAGE |
Tag : | Non |
Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Canis lupus familiaris(dog) ] |
Official Symbol | CXCL12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
Gene ID | 449622 |
mRNA Refseq | NM_001128097 |
Protein Refseq | NP_001121569 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
0
Inquiry Basket