Active Recombinant Human CXCL12, biotinylated

• Cat.No.: CXCL12-133H
• Product Overview: Recombinant human CXCL12a is produced in E. coli, biotinylated. Biotinylated enzymatically at the last lysine in the sequence.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: CXCL12a and CXCL12b, also known as Stromal Cell-Derived Factor 1α and 1β (SDF-1α and SDF-1β), are small cytokines that belong to the intercrine family. Both forms of CXCL12 are produced by alternate splicing of the same gene.
• Form: Lyophilized.
• Bio-activity: EC50 = 2.5nm determined by Calcium Flux with recombinant human CXCR4 cells. Migration confirmed with U937 cells expressing CXCR4.
• Molecular Mass: 10.4kDa by Mass Spec.
• AA Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKKLGSGLN DIFEAQKIEWHE
• Endotoxin: <0.01 EU per 1ug of protein by LAL method.
• Purity: >97% by SDS-PAGE
• Storage: 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution.
• Reconstitution: Recommended at 100ug/ml in sterile distilled water.

Gene Information

• Gene Name: CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ]
• Official Symbol: CXCL12
• Synonyms: CXCL12; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); SF; SCYB12; SDF-1a; SDF-1b; SDF1; SDF-1; SDF1A; SDF1B; TLSF; TLSF-a; TLSF-b; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; Stromal cell-derived factor 1 precursor; tromal cell-derived factor 1; stromal cell-derived factor 1 delta; stromal cell-derived factor 1 gamma; stromal cell-derived factor 1a
• Gene ID: 6387
• mRNA Refseq: NM_199168
• Protein Refseq: NP_954637
• MIM: 600835
• UniProt ID: P48061
• Chromosome Location: 10q11
• Pathway: CXCR4-mediated signaling events; Chemokine receptors bind chemokines; Chemokine signaling pathway; Class A/1 (Rhodopsin-like receptors); G alpha (i) signalling events; GPCR downstream signaling; HIF-1-alpha transcription factor network
• Function: chemokine activity; emokine activity; growth factor activity; signal transducer activity; receptor binding; CXCR chemokine receptor binding