Recombinant Brazilian scorpion Toxin Tb2-II protein, His&Myc-tagged
Cat.No. : | Toxin Tb2-II-4075B |
Product Overview : | Recombinant Brazilian scorpion Toxin Tb2-II protein(P60276)(1-62aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brazilian scorpion |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 1-62aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.0 kDa |
AA Sequence : | KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
TMPRSS11E-9451M | Recombinant Mouse TMPRSS11E Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC94-6214Z | Recombinant Zebrafish CCDC94 | +Inquiry |
ido-1489B | Recombinant Bacillus thuringiensis ido Protein (M1-K240), Flag/His-tagged | +Inquiry |
RFL17504HF | Recombinant Full Length Human Protein Nkg7(Nkg7) Protein, His-Tagged | +Inquiry |
CCDC85B-10820H | Recombinant Human CCDC85B, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
IgG-354G | Native Guinea Pig IgG | +Inquiry |
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN23-7464HCL | Recombinant Human CLDN23 293 Cell Lysate | +Inquiry |
EPHB2-001MCL | Recombinant Mouse EPHB2 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
DCLK1-001HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
CWC15-7176HCL | Recombinant Human CWC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Toxin Tb2-II Products
Required fields are marked with *
My Review for All Toxin Tb2-II Products
Required fields are marked with *
0
Inquiry Basket