Recombinant Bovine TARBP2 Protein (1-366 aa), His-Myc-tagged
Cat.No. : | TARBP2-2560B |
Product Overview : | Recombinant Bovine TARBP2 Protein (1-366 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Microbiology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-366 aa |
Description : | Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.8 kDa |
AA Sequence : | MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDVPVFTAAAAATPVPSAVPTRSSPMEVQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAEPEDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSAATREAARGEAARRALQYLKIMAGSK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | TARBP2 TARBP2 subunit of RISC loading complex [ Bos taurus (cattle) ] |
Official Symbol | TARBP2 |
Synonyms | TARBP2; |
Gene ID | 514674 |
mRNA Refseq | NM_001075678 |
Protein Refseq | NP_001069146 |
UniProt ID | Q0IIG6 |
◆ Recombinant Proteins | ||
TARBP2-2560B | Recombinant Bovine TARBP2 Protein (1-366 aa), His-Myc-tagged | +Inquiry |
TARBP2-10359Z | Recombinant Zebrafish TARBP2 | +Inquiry |
TARBP2-563HF | Recombinant Full Length Human TARBP2 Protein, GST-tagged | +Inquiry |
TARBP2-8421H | Recombinant Human TARBP2, GST-tagged | +Inquiry |
TARBP2-8473H | Recombinant Human TARBP2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TARBP2-1252HCL | Recombinant Human TARBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TARBP2 Products
Required fields are marked with *
My Review for All TARBP2 Products
Required fields are marked with *
0
Inquiry Basket