Recombinant Human TARBP2, GST-tagged

• Cat.No.: TARBP2-8421H
• Product Overview: Recombinant Human TARBP2(141 a.a. - 250 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 141-250 a.a.
• Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: Theoretical MW (kDa):37.84
• AA Sequence: RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKR NAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TARBP2 TAR (HIV-1) RNA binding protein 2 [ Homo sapiens ]
• Official Symbol: TARBP2
• Synonyms: LOQS; TRBP; TRBP1; TRBP2; RISC-loading complex subunit TARBP2; TAR (HIV) RNA binding protein 2; TAR (HIV) RNA-binding protein 2; TAR (HIV) RNA-binding protein TRBP1; TAR RNA binding protein 2; TAR RNA-binding protein 2; TARBP2; trans-activation responsive RNA-binding protein; trans-activation-responsive RNA-binding protein
• Gene ID: 6895
• mRNA Refseq: NM_134323
• Protein Refseq: NP_599150
• MIM: 605053
• UniProt ID: Q15633
• Chromosome Location: 12q13.13
• Pathway: Gene Expression, organism-specific biosystem; MicroRNA (miRNA) biogenesis, organism-specific biosystem; Small interfering RNA (siRNA) biogenesis, organism-specific biosystem
• Function: double-stranded RNA binding; miRNA binding; contributes_to pre-miRNA binding