Recombinant Bovine SFTPB Protein (23-187 aa), His-Myc-tagged

• Cat.No.: SFTPB-2286B
• Product Overview: Recombinant Bovine SFTPB Protein (23-187 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&Myc
• Protein Length: 23-187 aa
• Description: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 23.5 kDa
• AA Sequence: AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SFTPB surfactant protein B [ Bos taurus (cattle) ]
• Official Symbol: SFTPB
• Synonyms: SFTPB
• Gene ID: 507398
• mRNA Refseq: NM_001075311
• Protein Refseq: NP_001068779
• UniProt ID: P15781