Recombinant Human SFTPB Protein (201-279 aa)
Cat.No. : | SFTPB-2223H |
Product Overview : | Recombinant Human SFTPB Protein (201-279 aa) is produced by Yeast expression system. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Protein Length : | 201-279 aa |
Description : | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 8.7 kDa |
AA Sequence : | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SFTPB surfactant protein B [ Homo sapiens ] |
Official Symbol | SFTPB |
Synonyms | SFTPB; surfactant protein B; SP B; 6 kDa protein; SP-B; PSP-B; SFTB3; SFTP3; SMDP1; |
Gene ID | 6439 |
mRNA Refseq | NM_000542 |
Protein Refseq | NP_000533 |
MIM | 178640 |
UniProt ID | P07988 |
◆ Recombinant Proteins | ||
SFTPB-15020M | Recombinant Mouse SFTPB Protein | +Inquiry |
SFTPB-2395H | Recombinant Human SFTPB protein, His-SUMO-tagged | +Inquiry |
SFTPB-5017R | Recombinant Rat SFTPB Protein, His (Fc)-Avi-tagged | +Inquiry |
SFTPB-5294HFL | Recombinant Full Length Human SFTPB protein, Flag-tagged | +Inquiry |
SFTPB-1719H | Recombinant Human SFTPB protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *
0
Inquiry Basket