Recombinant Human SFTPB Protein (201-279 aa), MBP-tagged

• Cat.No.: SFTPB-2810H
• Product Overview: Recombinant Human SFTPB Protein (201-279 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Description: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
• Source: Baculovirus
• Species: Human
• Tag: MBP
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 50.7 kDa
• Protein length: 201-279 aa
• AA Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SFTPB surfactant protein B [ Homo sapiens ]
• Official Symbol: SFTPB
• Synonyms: SFTPB; surfactant protein B; SP B; 6 kDa protein; SP-B; PSP-B; SFTB3; SFTP3; SMDP1
• Gene ID: 6439
• mRNA Refseq: NM_000542
• Protein Refseq: NP_000533
• MIM: 178640
• UniProt ID: P07988