Recombinant Human SFTPB Protein (201-279 aa), MBP-tagged
Cat.No. : | SFTPB-2810H |
Product Overview : | Recombinant Human SFTPB Protein (201-279 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. |
Source : | Baculovirus |
Species : | Human |
Tag : | MBP |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 50.7 kDa |
Protein length : | 201-279 aa |
AA Sequence : | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SFTPB surfactant protein B [ Homo sapiens ] |
Official Symbol | SFTPB |
Synonyms | SFTPB; surfactant protein B; SP B; 6 kDa protein; SP-B; PSP-B; SFTB3; SFTP3; SMDP1; |
Gene ID | 6439 |
mRNA Refseq | NM_000542 |
Protein Refseq | NP_000533 |
MIM | 178640 |
UniProt ID | P07988 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *
0
Inquiry Basket